PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 327aa    MW: 36752.1 Da    PI: 4.8474
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-72682550PU_refplantGDBView CDS
gnl|UG|Pta#S25560683PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-1986139356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t eq+++Le+ Fe  ++++ +++ +LAk+lgL+ rq++vWFqNrRa++k
  Pta002586  86 KKRKLTFEQVKTLEKSFELRNKLDPDRKMQLAKQLGLEPRQISVWFQNRRARWK 139
                4568999**********************************************9 PP

2HD-ZIP_I/II117.38.5e-3885176192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkr+l+ eqvk+LE+sFe ++kL+p+rK++la++Lgl+prq+ vWFqnrRAR+ktkq+Ekd+++Lk++y++lk++ ++L +++++ ++e++
    Pta002586  85 EKKRKLTFEQVKTLEKSFELRNKLDPDRKMQLAKQLGLEPRQISVWFQNRRARWKTKQMEKDFDVLKHEYETLKKNYDMLLQKNRQFKDEVQ 176
                  69************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-2066143IPR009057Homeodomain-like
PROSITE profilePS5007117.13581141IPR001356Homeobox domain
SMARTSM003894.0E-1884145IPR001356Homeobox domain
PfamPF000462.1E-1686139IPR001356Homeobox domain
CDDcd000867.75E-1786142No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2088148IPR009057Homeodomain-like
PRINTSPR000316.3E-6112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000316.3E-6121137IPR000047Helix-turn-helix motif
PfamPF021832.8E-9141181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MACDGIPFRS SNNEEQSANS IAETKSMAET MSVGLPKGAV SLTSNECENT RKRSMSSSSL  60
SGAMDLSDHD NGEEDGSDDC PHFGEKKRKL TFEQVKTLEK SFELRNKLDP DRKMQLAKQL  120
GLEPRQISVW FQNRRARWKT KQMEKDFDVL KHEYETLKKN YDMLLQKNRQ FKDEVQWLSR  180
ELKISDQNSN VRASLIESQQ KPENSVPNLT ISPMELSVKS EICLNCTEQS RENYPTTIKE  240
QEGGCCSYMT EAASSIFNID SPRTIESPQS PGVPQIAAAS ANRSSPEIVV EGEVTTGVLK  300
TPPPGSGLDE WHCLPKVEMD QGTEESW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.159740.0cone| root| shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NQH81e-159A9NQH8_PICSI; Putative uncharacterized protein